General Information

  • ID:  hor000844
  • Uniprot ID:  A0A7M6UVK2(35-51)
  • Protein name:  Ecdysis triggering hormone
  • Gene name:  100117747
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DEPPAFFLKIAKNIPRI
  • Length:  17(35-51)
  • Propeptide:  MKRLVNTFISRNYILSAIFIVAVLAIIENKIVAADEPPAFFLKIAKNIPRIGRSEPYDEYAIKNSNVKDDIPWHKGEISKRRVGFSPESNTYAWQHFPLAIEGPPELWRTLAGYSHDPLYKTTDDFNNELWSRDKRTNNPEA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M6UVK2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000844_AF2.pdbhor000844_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 225493 Formula: C94H149N23O23
Absent amino acids: CGHMQSTVWY Common amino acids: IP
pI: 9.53 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 8
Hydrophobicity: -6.47 Boman Index: -1893
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 103.53
Instability Index: 5312.94 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis